DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Tle5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_034477.1 Gene:Tle5 / 14797 MGIID:95806 Length:197 Species:Mus musculus


Alignment Length:244 Identity:109/244 - (44%)
Similarity:136/244 - (55%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVM 65
            |:|.. ||..:...|.|  :|||.:|:.:|||:||..|||||||:||||:||::||:||||||||
Mouse     2 MFPQS-RHSGSSHLPQQ--LKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVM 63

  Fly    66 YYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQ 130
            |||||||||:|||||.||.||||.:..|:||:|..:||||||.|:|||||||..|||.||..|.|
Mouse    64 YYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQ 128

  Fly   131 HGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKP-TGLEG 194
               ...|.|:.|..:|         |.|.            |.||  :||.  .|.:.. |||..
Mouse   129 ---AHQLSQLQALALP---------LTPL------------PVGL--QPPS--LPAVSAGTGLLS 165

  Fly   195 PAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSD 243
            .:|...:...|                 :.|......:..|||:|||||
Mouse   166 LSALGSQTHLS-----------------KEDKNGHDGDTHQEDDGEKSD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 75/112 (67%)
WD40 442..727 CDD:238121
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791
WD40 repeat 537..573 CDD:293791
WD40 repeat 580..615 CDD:293791
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
Tle5NP_034477.1 TLE_N 11..132 CDD:397828 79/125 (63%)
CCN domain 166..197 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..197 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1980
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.