| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_318645.4 | Gene: | AgaP_AGAP009615 / 1278989 | VectorBaseID: | AGAP009615 | Length: | 778 | Species: | Anopheles gambiae |
| Alignment Length: | 434 | Identity: | 80/434 - (18%) |
|---|---|---|---|
| Similarity: | 134/434 - (30%) | Gaps: | 160/434 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 445 EVVCAVTISNPTKYVYTGGK-GCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVG 508
Fly 509 GEASNLSIWDLASPTPRI-KAELTSAAPACYALAISP--DSKVCFSCCSDGNIAVWDLHNEILVR 570
Fly 571 QFQGHTDGASCIDISPDGSR-----------LWT-----------------------GGLDNTVR 601
Fly 602 SWDL------------------REGRQLQQHDFSSQ------IFSLGY------CPTGDW----- 631
Fly 632 ---------LAVGMENSHVEVLHASKPDK-YQLHL--------HESCVLSLRFAACGKWFVSTGK 678
Fly 679 DNLLNAW---RTPYGASI-----------------------------------------FQSKET 699
Fly 700 SSV--LSCD--------------ISTDDKYIVTGSGDKKATVYE 727 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 80/432 (19%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/86 (10%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 7/53 (13%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 12/77 (16%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 11/39 (28%) | ||
| AgaP_AGAP009615 | XP_318645.4 | WD40 repeat | 24..66 | CDD:293791 | |
| WD40 | 60..587 | CDD:225201 | 80/434 (18%) | ||
| WD40 | 67..391 | CDD:238121 | 64/331 (19%) | ||
| WD40 repeat | 70..108 | CDD:293791 | 10/41 (24%) | ||
| WD40 repeat | 114..150 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 155..193 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 200..235 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 240..269 | CDD:293791 | 3/28 (11%) | ||
| WD40 | 316..618 | CDD:238121 | 31/179 (17%) | ||
| WD40 repeat | 413..462 | CDD:293791 | 4/48 (8%) | ||
| WD40 repeat | 467..503 | CDD:293791 | 9/26 (35%) | ||
| WD40 repeat | 510..545 | CDD:293791 | |||
| WD40 repeat | 551..587 | CDD:293791 | |||
| Utp13 | 639..770 | CDD:285789 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||