| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_311407.4 | Gene: | AgaP_AGAP010693 / 1272494 | VectorBaseID: | AGAP010693 | Length: | 888 | Species: | Anopheles gambiae |
| Alignment Length: | 246 | Identity: | 60/246 - (24%) |
|---|---|---|---|
| Similarity: | 103/246 - (41%) | Gaps: | 14/246 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 493 IRSVKLLPDGRTLIVG-GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDG 556
Fly 557 NIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSS--- 618
Fly 619 -QIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKY--QLHLHESCVLSLRFA--ACGKWFVSTGK 678
Fly 679 DNLLNAWRTPYGASIFQSKETSSVLSC-DISTDDKYIVTGSGDKKATVYEV 728 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 59/243 (24%) | ||
| WD40 repeat | 447..486 | CDD:293791 | |||
| WD40 repeat | 494..532 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/34 (26%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 3/24 (13%) | ||
| AgaP_AGAP010693 | XP_311407.4 | WD40 repeat | 19..58 | CDD:293791 | |
| WD40 | 20..486 | CDD:225201 | 33/131 (25%) | ||
| WD40 repeat | 59..97 | CDD:293791 | |||
| WD40 | <97..217 | CDD:295369 | |||
| WD40 repeat | 149..187 | CDD:293791 | |||
| WD40 repeat | 192..247 | CDD:293791 | |||
| WD40 repeat | 317..353 | CDD:293791 | |||
| WD40 | <335..662 | CDD:225201 | 60/246 (24%) | ||
| WD40 | 347..660 | CDD:238121 | 60/246 (24%) | ||
| WD40 repeat | 358..396 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 402..438 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 443..479 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 487..523 | CDD:293791 | 7/35 (20%) | ||
| WD40 repeat | 529..567 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 573..624 | CDD:293791 | 5/27 (19%) | ||
| WD40 repeat | 631..659 | CDD:293791 | |||
| Utp12 | 800..888 | CDD:281932 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||