| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598900.1 | Gene: | Wdr74 / 107071 | MGIID: | 2147427 | Length: | 384 | Species: | Mus musculus |
| Alignment Length: | 233 | Identity: | 51/233 - (21%) |
|---|---|---|---|
| Similarity: | 88/233 - (37%) | Gaps: | 32/233 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 427 VGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRD- 490
Fly 491 ------NYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVC 549
Fly 550 FSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQH 614
Fly 615 DF-SSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDK 651 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 44/218 (20%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/34 (26%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 6/32 (19%) | ||
| WD40 repeat | 661..695 | CDD:293791 | |||
| WD40 repeat | 702..726 | CDD:293791 | |||
| Wdr74 | NP_598900.1 | WD 1 | 40..80 | ||
| WD40 | <42..295 | CDD:225201 | 39/181 (22%) | ||
| WD40 | 45..302 | CDD:295369 | 41/188 (22%) | ||
| WD 2 | 83..122 | ||||
| WD40 repeat | 91..127 | CDD:293791 | |||
| WD 3 | 128..168 | 16/54 (30%) | |||
| WD40 repeat | 133..171 | CDD:293791 | 14/53 (26%) | ||
| WD 4 | 179..220 | 7/40 (18%) | |||
| WD40 repeat | 185..224 | CDD:293791 | 8/38 (21%) | ||
| WD 5 | 224..266 | 7/41 (17%) | |||
| WD40 repeat | 230..266 | CDD:293791 | 6/35 (17%) | ||
| WD 6 | 267..306 | 10/38 (26%) | |||
| Required for nucleolar and nuclear location. /evidence=ECO:0000250|UniProtKB:Q6RFH5 | 320..384 | 4/18 (22%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 323..384 | 3/15 (20%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||