DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and RACK1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_006089.1 Gene:RACK1 / 10399 HGNCID:4399 Length:317 Species:Homo sapiens


Alignment Length:279 Identity:71/279 - (25%)
Similarity:117/279 - (41%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 GIPRHARQINTLSHGEVVCAVTISNPTKYVYTGG-KGCVKVWDISQPGNKNPVSQLDCLQRDNYI 493
            |||:.|.:    .|...|..|.||:..::..:|. .|.:::||::     ...:....:.....:
Human    53 GIPQRALR----GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLT-----TGTTTRRFVGHTKDV 108

  Fly   494 RSVKLLPDGRTLIVGGEASNLSIWD-LASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGN 557
            .||....|.|.::.|.....:.:|: |......::.|..|...:|...:.:..:.:..||..|..
Human   109 LSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKL 173

  Fly   558 IAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFS 622
            :.||:|.|..|.....|||...:.:.:|||||...:||.|.....|||.||:.|...|....|.:
Human   174 VKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINA 238

  Fly   623 LGYCPTGDWL--AVG-------------MENSHVEVLH-ASKPDKYQLHLHESCVLSLRFAACGK 671
            |.:.|...||  |.|             ::....||:. :||.:..|      |. ||.::|.|:
Human   239 LCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQ------CT-SLAWSADGQ 296

  Fly   672 WFVSTGKDNLLNAWRTPYG 690
            ...:...|||:..|:...|
Human   297 TLFAGYTDNLVRVWQVTIG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 67/267 (25%)
WD40 repeat 447..486 CDD:293791 8/39 (21%)
WD40 repeat 494..532 CDD:293791 8/38 (21%)
WD40 repeat 537..573 CDD:293791 9/35 (26%)
WD40 repeat 580..615 CDD:293791 14/34 (41%)
WD40 repeat 620..653 CDD:293791 11/48 (23%)
WD40 repeat 661..695 CDD:293791 9/30 (30%)
WD40 repeat 702..726 CDD:293791
RACK1NP_006089.1 WD40 7..311 CDD:238121 69/273 (25%)
WD 1 13..44
WD40 repeat 18..61 CDD:293791 4/11 (36%)
WD 2 61..91 7/29 (24%)
WD40 repeat 67..103 CDD:293791 7/40 (18%)
WD 3 103..133 5/29 (17%)
WD40 repeat 108..144 CDD:293791 7/35 (20%)
WD 4 146..178 6/31 (19%)
WD40 repeat 152..189 CDD:293791 9/36 (25%)
WD 5 190..220 11/29 (38%)
WD40 repeat 195..231 CDD:293791 14/35 (40%)
WD 6 231..260 8/28 (29%)
WD40 repeat 236..279 CDD:293791 9/42 (21%)
WD 7 281..311 9/36 (25%)
WD40 repeat 286..310 CDD:293791 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.