DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wdr46

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_002938714.2 Gene:wdr46 / 100486235 XenbaseID:XB-GENE-489373 Length:592 Species:Xenopus tropicalis


Alignment Length:258 Identity:47/258 - (18%)
Similarity:97/258 - (37%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 EVVCAVTIS---NPTKYVYT------GGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLP 500
            :::|.:.:.   |..|:::|      ..:..:.::| ||.      .:|.|:::.|.:..::.||
 Frog   209 KLICEMNVMETVNDVKWLHTHTMYAAAQRRWLYIYD-SQG------VELHCIKKFNDVLRMEFLP 266

  Fly   501 DGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAI---SPDSKVCFSCCSDGNIAVWD 562
            ....|........|...|::     :..|:.:.......|.:   :|::.|......:|.:::|.
 Frog   267 YHFLLATCSSTGFLQYLDVS-----VGKEIAATCVKSGRLNVMCQNPNNAVIHLGHHNGTVSLWS 326

  Fly   563 -LHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYC 626
             ...|.||:.. .|......:.:...|..:.:.|||..:..:|:|..|.|     :|.:..||  
 Frog   327 PSMKEPLVKML-CHRGAVRALSVDKTGMYMASSGLDRKLTIFDMRTYRPL-----TSCLLPLG-- 383

  Fly   627 PTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPY 689
                  |..:.:|...:|.|...|..|::                      ||..::..|:||
 Frog   384 ------AGSLCHSQKGLLAAGTGDIVQVY----------------------KDTSVSPPRSPY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 47/258 (18%)
WD40 repeat 447..486 CDD:293791 8/47 (17%)
WD40 repeat 494..532 CDD:293791 6/37 (16%)
WD40 repeat 537..573 CDD:293791 8/39 (21%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 7/32 (22%)
WD40 repeat 661..695 CDD:293791 5/29 (17%)
WD40 repeat 702..726 CDD:293791
wdr46XP_002938714.2 WD40 <187..447 CDD:225201 47/258 (18%)
WD40 repeat 221..256 CDD:293791 8/41 (20%)
WD40 repeat 259..294 CDD:293791 6/39 (15%)
WD40 repeat 302..337 CDD:293791 7/34 (21%)
WD40 repeat 343..377 CDD:293791 8/38 (21%)
BING4CT 417..495 CDD:198101 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.