DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and BHLHE40

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_003661.1 Gene:BHLHE40 / 8553 HGNCID:1046 Length:412 Species:Homo sapiens


Alignment Length:176 Identity:46/176 - (26%)
Similarity:75/176 - (42%) Gaps:36/176 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVA---- 72
            |:...::|::||.|:|:|:..||.|:.|      .|::.....||.||:.....|..|.:.    
Human    54 KLPHRLIEKKRRDRINECIAQLKDLLPE------HLKLTTLGHLEKAVVLELTLKHVKALTNLID 112

  Fly    73 -QEEQSLPLDS------------------FKNGYMNAVNEVSRVMASTPGMSVDLGKS-VMTHLG 117
             |:::.:.|.|                  |.:|:.....||.:.:|.... :.||..| ::|||.
Human   113 QQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHEN-TRDLKSSQLVTHLH 176

  Fly   118 RVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPA--SSGYHSDC 161
            ||...|.|...::..:|.....||   ..:.|.|||  |.|...:|
Human   177 RVVSELLQGGTSRKPSDPAPKVMD---FKEKPSSPAKGSEGPGKNC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 16/54 (30%)
ORANGE 81..125 CDD:128787 15/62 (24%)
BHLHE40NP_003661.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer 1..139 21/90 (23%)
bHLH-O_DEC1 40..129 CDD:381592 21/80 (26%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 14/44 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..303 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.