DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and HES7

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_016880721.1 Gene:HES7 / 84667 HGNCID:15977 Length:265 Species:Homo sapiens


Alignment Length:221 Identity:50/221 - (22%)
Similarity:84/221 - (38%) Gaps:58/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGIL--RMDKAEMLESAVIFMRQQK-------- 66
            |:.||::|::||.|:|:.|:.|:.|:.|...|..:.  :::|||:||.||.::|::.        
Human    49 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPAAA 113

  Fly    67 ---TPKKVAQEEQSLP---LDSFK-------------------------NGYMNAVNEVSRVM-- 98
               .|:...|:.::|.   |..|:                         :||:.......:.:  
Human   114 APGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVDP 178

  Fly    99 -ASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCS-----SMDKAPLS----PA 153
             ...|..|:|   .....||.........|:...:.....:...||     |...|||:    |.
Human   179 RPPAPRPSLD---PAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPP 240

  Fly   154 SSGYHSDCDSPAPSPQPMQQPLWRPW 179
            ...:..|....||.|.|  ...||||
Human   241 PPPHRQDGAPKAPLPPP--PAFWRPW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/67 (31%)
ORANGE 81..125 CDD:128787 8/71 (11%)
HES7XP_016880721.1 HLH 49..108 CDD:238036 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.