DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:87/219 - (39%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGIL--RMDKAEMLESAVIFMRQQK------TP 68
            |:.||::|::||.|:|:.|:.|:.|:.|...|..:.  :::|||:||.||.::|::.      .|
Mouse    14 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVP 78

  Fly    69 KKVAQEEQSLP---LDSFK-------------------------NGYMNAVNEVSRVMASTPGM- 104
            :...|:.::|.   |..|:                         :||...  :..|..|..||: 
Mouse    79 RSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARSQLFSALHGYRRP--KPPRPEAVDPGLP 141

  Fly   105 ----SVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSM-----DKAPLS----PASSG 156
                .:|....:   ||.........|:...:.....:...|||.     ..|||:    |....
Mouse   142 APRPPLDPASPI---LGPALHQRPPVHQGPPSPRLAWSPSHCSSRAGDSGAPAPLTGLLPPPPPP 203

  Fly   157 YHSDCDSPAPS-PQPMQQPLWRPW 179
            |..|....||| |.|   ..||||
Mouse   204 YRQDGAPKAPSLPPP---AFWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/62 (34%)
ORANGE 81..125 CDD:128787 10/73 (14%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 21/58 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 28/109 (26%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.