DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Bhlhe40

DIOPT Version :10

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_445780.2 Gene:Bhlhe40 / 79431 RGDID:68439 Length:411 Species:Rattus norvegicus


Alignment Length:211 Identity:46/211 - (21%)
Similarity:80/211 - (37%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYTTKTQIYQ---------------KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMD 50
            |::....|:|:               |:...::|::||.|:|:|:..||.|:.|      .|::.
  Rat    28 MDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPE------HLKLT 86

  Fly    51 KAEMLESAVIFMRQQKTPKKVA-----QEEQSLPLDS------------------FKNGYMNAVN 92
            ....||.||:.....|..|.:.     |:::.:.|.|                  |.:|:.....
  Rat    87 TLGHLEKAVVLELTLKHVKALTNLIDQQQQKIMALQSGLQAGDLSGRNIEAGQEMFCSGFQTCAR 151

  Fly    93 EVSRVMASTPGMSVDLGKS-VMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAP------- 149
            ||.:.:|.... :.||..| ::|||.||            .::.:|.|.....:|.||       
  Rat   152 EVLQYLAKHEN-TRDLKSSQLVTHLHRV------------VSELLQGSASRKPLDSAPKPVDFKE 203

  Fly   150 ----LSPASSGYHSDC 161
                |:..|.|...:|
  Rat   204 KPSFLAKGSEGPGKNC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 bHLH-O_ESM5_like 12..70 CDD:381486 17/57 (30%)
ORANGE 81..125 CDD:128787 14/62 (23%)
Bhlhe40NP_445780.2 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 24/116 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
bHLH-O_DEC1 40..129 CDD:381592 21/94 (22%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 13/56 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..293 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.