DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and BHLHE41

DIOPT Version :10

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens


Alignment Length:109 Identity:32/109 - (29%)
Similarity:56/109 - (51%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLE------SAVIFMRQQKTPKK 70
            |:...::|::||.|:|:|:..||.|:.|......:..::||.:||      .|:..:.:|:..|.
Human    46 KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKI 110

  Fly    71 VAQE--EQSL------PLDSFKNGYMNAVNEV----SRVMASTP 102
            :|.:  |:||      .||:|.:|:.....||    ||..:.||
Human   111 IALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 bHLH-O_ESM5_like 12..70 CDD:381486 17/63 (27%)
ORANGE 81..125 CDD:128787 9/26 (35%)
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 22/75 (29%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 2/3 (67%)
ORANGE 129..175 CDD:128787 9/26 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.