DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:197 Identity:45/197 - (22%)
Similarity:78/197 - (39%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLV-AELRGDDGILRMDKAEMLESAVIFMRQQK--------- 66
            :::||::|:.||.|:|..::.||.|: .|........:::||::||.||.:::..|         
  Rat    18 RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGELGACARV 82

  Fly    67 -TPKKVAQEEQS--LPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHE 128
             .|..||...::  :|| .....:..|....|.....:.|.|..|.::|            ||..
  Rat    83 LLPTGVAPTARAPLMPL-GLPTAFAAAAGPKSLHQDYSEGYSWCLQEAV------------QFLT 134

  Fly   129 AQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQP----------------LWR 177
            ..:|:|.....:.......||.:|.     .:..:|..:|||.:..                |||
  Rat   135 LHAASDTQMKLLYHFQRPPAPAAPV-----KETPTPGAAPQPARSSTKAAASVSTSRQSACGLWR 194

  Fly   178 PW 179
            ||
  Rat   195 PW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 18/65 (28%)
ORANGE 81..125 CDD:128787 6/43 (14%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 17/55 (31%)
ORANGE 116..158 CDD:128787 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.