DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and her7

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:201 Identity:51/201 - (25%)
Similarity:89/201 - (44%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDD----GILRMDKAEMLESAVIFMRQQKTPKK 70
            :.|:.||.:||:||.|||:.|:|||.|:  |:|.:    ...|::|||:||..|:|:::   ..|
Zfish    28 FLKLLKPQVERRRRERMNRSLENLKLLL--LQGPEHNQPNQRRLEKAEILEYTVLFLQK---ANK 87

  Fly    71 VAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGK-------------SVMTHLGRVYKN 122
            .::||:......|..|:.:.:.:.:|.:....|:...:..             .|..|..:.:..
Zfish    88 ASKEEEGEEKSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRKQHAE 152

  Fly   123 LQQFHEAQ--------------SAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQ 173
            ....|.|:              ||.   :|:.:..:...|..|..|:..||.....:..|:|..|
Zfish   153 SNPQHHARRPHHKNTVSKAGHPSAC---RNTKEPQASRAAFRSTDSNTKHSTAQPTSRHPEPASQ 214

  Fly   174 PLWRPW 179
            .:||||
Zfish   215 TVWRPW 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 25/60 (42%)
ORANGE 81..125 CDD:128787 6/56 (11%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 4/34 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.