DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and HES4

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001135939.1 Gene:HES4 / 57801 HGNCID:24149 Length:247 Species:Homo sapiens


Alignment Length:204 Identity:49/204 - (24%)
Similarity:81/204 - (39%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KPMLERQRRARMNKCLDNLKTLVAE-LRGDDG-ILRMDKAEMLESAVIFMRQ-QKTPKKVAQEEQ 76
            ||::|::||||:|:.|..||||:.: ||.:.. ..:::||::||..|..:|. ::.....|....
Human    65 KPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSAD 129

  Fly    77 SLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMD 141
            ...|..::.|:...:.||:|.:|...|:..|:...::.||....:.|.                 
Human   130 PAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLG----------------- 177

  Fly   142 CSSMDKAPLSPASSGYHSDCDSPAP-------------SPQPMQQP------------------- 174
             .|...|.||||     :..::|||             .|.|:..|                   
Human   178 -PSRRPASLSPA-----APAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQ 236

  Fly   175 ----LWRPW 179
                .||||
Human   237 GPGGPWRPW 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/54 (39%)
ORANGE 81..125 CDD:128787 10/43 (23%)
HES4NP_001135939.1 HLH 62..119 CDD:238036 21/53 (40%)
Hairy_orange 136..174 CDD:284859 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.