DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:213 Identity:53/213 - (24%)
Similarity:92/213 - (43%) Gaps:68/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLK-TLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQE 74
            :|::||::||:||.|:|.|||.|: |:||..:.|..  :::||::||..|      |..:.:...
Zfish    23 RKLRKPLIERKRRERINLCLDQLRETVVAVFKPDQS--KLEKADILEMTV------KHLQNIQSS 79

  Fly    75 EQSLPL------DSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAA 133
            ..|.|:      ..:..||:..:.||..::.|...|...||..::.||   :|:|.         
Zfish    80 RVSDPVLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHL---FKSLP--------- 132

  Fly   134 DFIQNSMDCSSMDKAPLS--PAS----SGYHSDCDSPAPSP-------------------QPMQQ 173
               .::.||..:.|..|:  |:.    |.:|.| ::.:|.|                   .|::.
Zfish   133 ---LSAKDCPRLPKTSLTSVPSDHSEYSSFHVD-ETASPKPCSSSPFLCKRPNQSQNQHFTPIRM 193

  Fly   174 P------------LWRPW 179
            |            :||||
Zfish   194 PHDVESSHLSVLQMWRPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/56 (39%)
ORANGE 81..125 CDD:128787 12/43 (28%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 23/61 (38%)
Hairy_orange 94..132 CDD:284859 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.