DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and bhlhe41

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001034196.1 Gene:bhlhe41 / 563771 ZFINID:ZDB-GENE-050419-146 Length:421 Species:Danio rerio


Alignment Length:129 Identity:32/129 - (24%)
Similarity:63/129 - (48%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLE------SAVIFMRQQKTPKK 70
            |:...::|::||.|:|:|:..||.|:.|......:..::||.:||      :|:..:.:|:..|.
Zfish    46 KLPHRLIEKKRRDRINECIGQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLNALTAVTEQQHQKI 110

  Fly    71 VAQE--EQSL------PLDSFKNGYMNAVNEVSRVMASTPGMSVDLGK--SVMTHLGRVYKNLQ 124
            :|.:  |:||      .||:|.:|:.....||.:.:......:....:  .::.||.:|....|
Zfish   111 IALQNGERSLKSSLQADLDAFHSGFQACAKEVLQYLNKVENWTAREQRCTRLINHLHKVSAQFQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 17/60 (28%)
ORANGE 81..125 CDD:128787 9/46 (20%)
bhlhe41NP_001034196.1 HLH 46..99 CDD:238036 15/52 (29%)
Hairy_orange 131..171 CDD:284859 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.