Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062352.1 | Gene: | Hes6 / 55927 | MGIID: | 1859852 | Length: | 224 | Species: | Mus musculus |
Alignment Length: | 208 | Identity: | 53/208 - (25%) |
---|---|---|---|
Similarity: | 89/208 - (42%) | Gaps: | 48/208 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEE 75
Fly 76 QSLPLDS---FKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQ 137
Fly 138 NSM-------DCSSMDK--APLSPASS--GYHSDCDS-------------PAPSPQPMQ------ 172
Fly 173 ------QPLWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 21/55 (38%) |
ORANGE | 81..125 | CDD:128787 | 7/46 (15%) | ||
Hes6 | NP_062352.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 1/4 (25%) | |
bHLH_SF | 24..81 | CDD:412148 | 21/59 (36%) | ||
Hairy_orange | 96..134 | CDD:400076 | 7/41 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..209 | 14/62 (23%) | |||
WRPW motif | 221..224 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830826 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.700 |