DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:208 Identity:53/208 - (25%)
Similarity:89/208 - (42%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEE 75
            :|.:||::|::||||:|:.|..|:.|:|   |.:...:::.||:||..|  .|.|...:..|:|.
Mouse    26 RKARKPLVEKKRRARINESLQELRLLLA---GTEVQAKLENAEVLELTV--RRVQGALRGRARER 85

  Fly    76 QSLPLDS---FKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQ 137
            :.|..::   |..||:..::||...:::...:...:...::.||    .......|..|..|.:.
Mouse    86 EQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHL----LESMPLREGSSFQDLLG 146

  Fly   138 NSM-------DCSSMDK--APLSPASS--GYHSDCDS-------------PAPSPQPMQ------ 172
            :|:       ..||...  :|.||.||  |...|..|             ||..|..:.      
Mouse   147 DSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGSL 211

  Fly   173 ------QPLWRPW 179
                  |.:||||
Mouse   212 TAARRAQSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/55 (38%)
ORANGE 81..125 CDD:128787 7/46 (15%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 1/4 (25%)
bHLH_SF 24..81 CDD:412148 21/59 (36%)
Hairy_orange 96..134 CDD:400076 7/41 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 14/62 (23%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.