DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hes2.1

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:194 Identity:61/194 - (31%)
Similarity:88/194 - (45%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG--ILRMDKAEMLESAVIFMRQQKTPKKVAQ 73
            :|..||::|::||||:|..|::||||:..|.|.|.  ..:::||::||..|.|:|.  .|...|:
Zfish    30 RKTLKPLMEKRRRARINDSLNHLKTLILPLVGKDASRYSKLEKADILEMTVRFLRD--LPSSSAK 92

  Fly    74 EEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEA-QSAADFIQ 137
            .:    .||:|.||...:..:|.::..:                    ||:.  || |..::|||
Zfish    93 GQ----TDSYKEGYKACLQRISTMLPQS--------------------NLET--EAHQRVSEFIQ 131

  Fly   138 NSMDCSSMD----KAPLSPASSGYHSDCDS--------------PAPS-PQPMQQ---PLWRPW 179
            .||..||..    .|..|...|..|....|              |||| |||..|   .:||||
Zfish   132 QSMASSSSSCQNCCAQNSKMISQMHQRLVSLRNNNSMENPISTVPAPSQPQPAPQAAEDMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 24/57 (42%)
ORANGE 81..125 CDD:128787 8/43 (19%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.