DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Helt

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_008769494.1 Gene:Helt / 498633 RGDID:1564073 Length:241 Species:Rattus norvegicus


Alignment Length:216 Identity:49/216 - (22%)
Similarity:80/216 - (37%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTQIYQKVKKPMLERQRRARMNKCLDNL-KTL-VAELRGDDGILRMDKAEMLESAVIFMRQQKTP 68
            :|.:..||    :|::||.|:|:||:.| ||: :|..:...|  :::|||:||..|.::|...:.
  Rat    10 RTPVSHKV----IEKRRRDRINRCLNELGKTVPMALAKQSSG--KLEKAEILEMTVQYLRALHSA 68

  Fly    69 KKVAQEEQSLPLDSFKN----GYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ----- 124
            ......|::..|..|.|    ||...:..:...:.:...|     ::..|...|:...||     
  Rat    69 DFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERM-----ETKDTKYARILAFLQSKARL 128

  Fly   125 ------------------QFHEA---------QSAADFIQNSMDCS-----SMDKAPLSPASSGY 157
                              |.|.|         ..|..|.|.:...|     ...::|..|    |
  Rat   129 GAEPAFPPLSLPEPDFSYQLHPAGPEFPGHSPGEATVFPQGATPGSFPWPPGAARSPALP----Y 189

  Fly   158 HSDCDSPAPSPQPMQQPLWRP 178
            .|....|.|:|.....|...|
  Rat   190 LSSATVPLPTPAQPHSPFLAP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/58 (36%)
ORANGE 81..125 CDD:128787 9/70 (13%)
HeltXP_008769494.1 bHLH-O_HELT 14..69 CDD:381414 21/60 (35%)
Hairy_orange 87..127 CDD:400076 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.