DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and cwo

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:165 Identity:41/165 - (24%)
Similarity:75/165 - (45%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYTT----KTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFM 62
            ||.|    ||.....:...::|::||.|||.||.:|..|:.......|..|::|.|::|.|:   
  Fly    50 EYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAI--- 111

  Fly    63 RQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTH--LGRVYKNLQQ 125
            |..|..:...|:::|    .:::|||:.:.|.::.:       .|:......|  |||:.:::.:
  Fly   112 RHLKHLQSECQQKES----DYRSGYMDCMKEAAKFL-------YDVHMQDFCHRLLGRLQEHIDE 165

  Fly   126 FHEAQSAADFIQNSMDCSSMDKAPLSPAS--SGYH 158
            ..:    .|..:::..|...|....|..|  ..||
  Fly   166 MFK----TDCYKSTRSCHMPDNVSASSGSPHQAYH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 17/56 (30%)
ORANGE 81..125 CDD:128787 9/45 (20%)
cwoNP_524775.1 HLH 66..118 CDD:306515 18/54 (33%)
ORANGE 126..168 CDD:128787 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.