DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and E(spl)m7-HLH

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster


Alignment Length:191 Identity:79/191 - (41%)
Similarity:106/191 - (55%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPK 69
            :||..|:||.||:|||:||||:|||||.||.|:||.....|..:.:||::||..|..:|:.|..|
  Fly     8 SKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESK 72

  Fly    70 K--VAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHE---- 128
            |  .|..||     ||:.||:.|.|||||.:||.|.:.|..|.::|||||.....|:|..|    
  Fly    73 KHVPANPEQ-----SFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQA 132

  Fly   129 ----------AQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179
                      :.|::....::..|||     :||.||||.||.:|......|.|  :||||
  Fly   133 VNTPLSIVCGSSSSSSTYSSASSCSS-----ISPVSSGYASDNESLLQISSPGQ--VWRPW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 29/56 (52%)
ORANGE 81..125 CDD:128787 21/43 (49%)
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 30/59 (51%)
ORANGE 81..125 CDD:128787 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.