DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:182 Identity:109/182 - (59%)
Similarity:137/182 - (75%) Gaps:19/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKT 67
            :.:|||.|.|||||:||||||||||||||.|||||||.:|||.|||||||||||:|::|||    
  Fly    11 FVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR---- 71

  Fly    68 PKKVAQEE---QSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEA 129
             |:|.:::   ..||:|||||||||||:|:|||||.||.||||:||:||||||..::.:.|    
  Fly    72 -KQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQ---- 131

  Fly   130 QSAADFIQNSMDCSSMDKAPLSPASSGYHSDCD--SPAPSPQPMQQPLWRPW 179
               ||.:|.|:..|:  ..||||||||||||.:  ..|.||:|:::.:||||
  Fly   132 ---ADQVQTSVTTST--PRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 45/56 (80%)
ORANGE 81..125 CDD:128787 31/43 (72%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 44/56 (79%)
ORANGE 87..131 CDD:128787 31/43 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.