DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:197 Identity:75/197 - (38%)
Similarity:112/197 - (56%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG--ILRMDKAEMLESAVIFMRQQKT 67
            :||..|:||.||||||:||||:|||||.||.::.|....:|  |.|::||::||..|..|::.:.
  Fly     8 SKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRA 72

  Fly    68 PKKV------------AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVY 120
            .|::            |..:.|: .:||:.||::|.||||:.:|:.||:|||||..:|:|||...
  Fly    73 QKQLRLSSVTGGVSPSADPKLSI-AESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRL 136

  Fly   121 KNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCD-------SPAPS-PQPMQQPLWR 177
            ..||....:......:|..::    |:|.::|..    |:||       ||||| ......|:||
  Fly   137 NYLQVVVPSLPIGVPLQAPVE----DQAMVTPPP----SECDSLESGACSPAPSEASSTSGPMWR 193

  Fly   178 PW 179
            ||
  Fly   194 PW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 30/58 (52%)
ORANGE 81..125 CDD:128787 22/43 (51%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/61 (49%)
ORANGE 97..141 CDD:128787 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469364
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.