DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and her12

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:180 Identity:47/180 - (26%)
Similarity:80/180 - (44%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLV-AELRGDDGILRMDKAEMLESAVIFMRQ 64
            :.::.|.:|  |::||::|:.||.|:|.|:|.||:|: .|....|...:::||::||..|.|::|
Zfish    14 LHFSDKEKI--KLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSHDPSTKLEKADILEMTVSFLKQ 76

  Fly    65 QKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEA 129
            |      .:::|.:|...|..||.:...|      |...:|:......:.||....|........
Zfish    77 Q------IKQQQQIPQRDFNEGYSHCWRE------SVHFLSLHSNAGELQHLHSGPKTNSTMGST 129

  Fly   130 QSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179
            .:.|        ||.::.|.|.      |.|          ..:.:||||
Zfish   130 PATA--------CSKLNTAALQ------HPD----------SVRAVWRPW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 23/57 (40%)
ORANGE 81..125 CDD:128787 9/43 (21%)
her12NP_991182.1 HLH 19..74 CDD:238036 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.