DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hes4

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_988870.1 Gene:hes4 / 394465 XenbaseID:XB-GENE-487830 Length:281 Species:Xenopus tropicalis


Alignment Length:170 Identity:45/170 - (26%)
Similarity:78/170 - (45%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71
            ::|..||::|::||||:|:.|..||||:.:....|..  .:::||::||..|..:|. |:.....
 Frog    34 HRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTA 98

  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGR-----VYKNLQQFHEAQS 131
            |.......|..::.|:...:|||:|.:::..|::.::...::.||..     |..|.||...:|.
 Frog    99 ALTADPSVLGKYRAGFNECMNEVTRFLSTCEGVNTEVRTRLLGHLSSCLGQIVAMNYQQPPSSQQ 163

  Fly   132 AADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPM 171
                             ||       |....|..|:|.||
 Frog   164 -----------------PL-------HVQLPSSTPAPVPM 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/59 (37%)
ORANGE 81..125 CDD:128787 10/48 (21%)
hes4NP_988870.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 3/9 (33%)
bHLH-O_HES1_4 33..95 CDD:381465 22/60 (37%)
Hairy_orange 110..147 CDD:369405 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
WRPW motif. /evidence=ECO:0000255 278..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.