DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and HES3

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001019769.1 Gene:HES3 / 390992 HGNCID:26226 Length:186 Species:Homo sapiens


Alignment Length:213 Identity:48/213 - (22%)
Similarity:81/213 - (38%) Gaps:86/213 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LERQRRARMNKCLDNLKTLVA-----ELRGDDGILRMDKAEMLESAVIFMR------QQKTPKKV 71
            :|::||||:|..|:.||:|:.     ::|.    .:::||::||.:|.:||      |...|...
Human     1 MEKKRRARINVSLEQLKSLLEKHYSHQIRK----RKLEKADILELSVKYMRSLQNSLQGLWPVPR 61

  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFI 136
            ..|:.|        |:.:.:..||:::.    ...::|..:...|           ..:|||.  
Human    62 GAEQPS--------GFRSCLPGVSQLLR----RGDEVGSGLRCPL-----------VPESAAG-- 101

  Fly   137 QNSMDCSSMDKAPL------------------SPASSGYHS------------DCDSPAPSPQP- 170
                  |:||.|.|                  :||:.|..|            ...:..|.||| 
Human   102 ------STMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPA 160

  Fly   171 ----MQQP-----LWRPW 179
                .:.|     :||||
Human   161 SSRCAESPGLGLRVWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 19/59 (32%)
ORANGE 81..125 CDD:128787 5/43 (12%)
HES3NP_001019769.1 HLH 1..54 CDD:238036 18/56 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..186 13/51 (25%)
WRPW motif 175..178 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.