DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and HES5

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:199 Identity:44/199 - (22%)
Similarity:75/199 - (37%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLV-AELRGDDGILRMDKAEMLESAVIFMRQQK--------- 66
            :::||::|:.||.|:|..::.||.|: .|........:::||::||.||.:::..|         
Human    18 RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRA 82

  Fly    67 --------TPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNL 123
                    .|:..|:.    |.......::.|....|.....:.|.|..|.::|           
Human    83 PSSHRAPAPPRPAARS----PPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAV----------- 132

  Fly   124 QQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSP----------QPMQQP---L 175
             ||....:|:|.....:  ....:.|.:||:..........||.|          ....||   |
Human   133 -QFLTLHAASDTQMKLL--YHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGL 194

  Fly   176 WRPW 179
            ||||
Human   195 WRPW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 18/72 (25%)
ORANGE 81..125 CDD:128787 6/43 (14%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 17/52 (33%)
Hairy_orange 118..153 CDD:295407 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.