DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hes6

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:218 Identity:57/218 - (26%)
Similarity:93/218 - (42%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAV-----IFMRQQKTPKK 70
            :|.:||::|::||||:|:.|..|:.|:|:   .|..::|:.||:||..|     |...:.|....
Zfish    20 RKTRKPLVEKKRRARINESLQELRLLLAD---PDAQVKMENAEVLEMTVKRVESILQNKAKEADS 81

  Fly    71 VAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRV--YKNLQQFHEAQSAA 133
            |.:|..    :.|..||:..::||...::|.||:...:...::.||...  ..:.::|.:..|  
Zfish    82 VNREAN----ERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHLLECMPLNDEERFQDILS-- 140

  Fly   134 DFIQNSMDCSSMD----KAPLSP-----ASSGYHSDCDSPAPSPQPM------------------ 171
            |.|.:|.:..:..    .|.|||     |:.|  |...|||||....                  
Zfish   141 DLISDSNNSGTWPGEAAYATLSPGGTSVANGG--SSALSPAPSTTSSDDICSDLDDTDTEHSRIS 203

  Fly   172 -----QQP----------LWRPW 179
                 |.|          :||||
Zfish   204 VDAGDQAPVVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/60 (35%)
ORANGE 81..125 CDD:128787 10/45 (22%)
hes6NP_919381.2 HLH 18..75 CDD:238036 21/57 (37%)
Hairy_orange 90..128 CDD:284859 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.