DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and heyl

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_859425.1 Gene:heyl / 335134 ZFINID:ZDB-GENE-030131-7074 Length:310 Species:Danio rerio


Alignment Length:170 Identity:41/170 - (24%)
Similarity:75/170 - (44%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMR-QQKT 67
            :|...:.:|.::.::|::||.|:|..|..|:.||.......|..:::|||:|:..|..:: ....
Zfish    37 STSQILARKKRRGIIEKRRRDRINHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAM 101

  Fly    68 PKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGM--SVDLGKSVMTHLGRVYKNLQQFHEAQ 130
            ..|...:.::|.:|....|:...|.||.|.::|..|:  |..:|..:::||......|....::.
Zfish   102 GGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLLQSP 166

  Fly   131 SAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQP 170
            :|..|             |..|.:|.......||..|..|
Zfish   167 AALPF-------------PPWPWASFPQLQAASPPASSTP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 16/57 (28%)
ORANGE 81..125 CDD:128787 13/45 (29%)
heylNP_859425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HLH 44..101 CDD:238036 16/56 (29%)
ORANGE 115..159 CDD:128787 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.