DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hesr

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster


Alignment Length:185 Identity:47/185 - (25%)
Similarity:79/185 - (42%) Gaps:61/185 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG--ILRMDKAEMLESAVIFMRQQKT 67
            :::..|::|.|||:||:||:|:|:|||.:|.|:.|:...||  :.:||..::||.||..:.::..
  Fly    16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNC 80

  Fly    68 PKKVAQEE--------QSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ 124
            |  ||...        || |:|.:.:|:...|.|||:.:                          
  Fly    81 P--VATPTTAPTSGVYQS-PIDCYWSGFRECVLEVSQFL-------------------------- 116

  Fly   125 QFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179
            |.:..|.:.:|.:                      :.|....|....:..|||||
  Fly   117 QHNGYQPSFEFAK----------------------ELDHLVASTSKSKPNLWRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 25/58 (43%)
ORANGE 81..125 CDD:128787 6/43 (14%)
HesrNP_525094.1 HLH 21..77 CDD:238036 25/55 (45%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.