Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005515.1 | Gene: | HES1 / 3280 | HGNCID: | 5192 | Length: | 280 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 50/245 - (20%) |
---|---|---|---|
Similarity: | 88/245 - (35%) | Gaps: | 75/245 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71
Fly 72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ------QFHEAQ 130
Fly 131 SA--------------------------------------------------------------- 132
Fly 133 -ADFIQNSMDCSSMDKAPLSPASSG--YHSDCDSPAPSPQPMQQPLWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 22/59 (37%) |
ORANGE | 81..125 | CDD:128787 | 8/49 (16%) | ||
HES1 | NP_005515.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 3/9 (33%) | |
bHLH-O_HES1_4 | 33..95 | CDD:381465 | 22/60 (37%) | ||
Hairy_orange | 110..148 | CDD:400076 | 8/37 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..200 | 4/42 (10%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 254..280 | 7/25 (28%) | |||
WRPW motif | 275..278 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140912 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |