DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and HES1

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:245 Identity:50/245 - (20%)
Similarity:88/245 - (35%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71
            ::|..||::|::||||:|:.|..||||:.:....|..  .:::||::||..|..:|. |:.....
Human    34 HRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTA 98

  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ------QFHEAQ 130
            |.......|..::.|:...:|||:|.:::..|::.::...::.||......:.      |.|.|.
Human    99 ALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPAL 163

  Fly   131 SA--------------------------------------------------------------- 132
            .|                                                               
Human   164 QAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQ 228

  Fly   133 -ADFIQNSMDCSSMDKAPLSPASSG--YHSDCDSPAPSPQPMQQPLWRPW 179
             |..|.|.....|....|:..::||  ...:..||:..|......:||||
Human   229 FAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/59 (37%)
ORANGE 81..125 CDD:128787 8/49 (16%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 3/9 (33%)
bHLH-O_HES1_4 33..95 CDD:381465 22/60 (37%)
Hairy_orange 110..148 CDD:400076 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 4/42 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 7/25 (28%)
WRPW motif 275..278 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.