DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and bhlhe40

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_997844.2 Gene:bhlhe40 / 324413 ZFINID:ZDB-GENE-030131-3133 Length:403 Species:Danio rerio


Alignment Length:201 Identity:46/201 - (22%)
Similarity:76/201 - (37%) Gaps:60/201 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVI-------------FMR 63
            |:...::|::||.|:|:|:..||.|:.|      .|::.....||.||:             .:.
Zfish    51 KLPHRLIEKKRRDRINECIAQLKDLLPE------HLKLTTLGHLEKAVVLELTLKHVKALNNLLE 109

  Fly    64 QQKTPKKVAQEEQSLPL------------DSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHL 116
            ||:  :|:...:..|.:            :.|::|:.....||.:.:|:...|.......::.||
Zfish   110 QQQ--QKIISLQNGLQIGEQGNGPSENSEEMFRSGFHLCAKEVLQFLANQETMRDLTTAHIIEHL 172

  Fly   117 GRVYKNLQQ------FHEAQSAADFIQNSMDCSS--MDKA----------------PLSPASSGY 157
            .:|...|.|      ..|..|.|   |.|.:..|  ..||                |.|...||.
Zfish   173 QKVASELIQSPPSPRLDEPASKA---QESREKPSGLQPKAAEGHAKNCVPVIQRTYPHSSEQSGS 234

  Fly   158 HSDCDS 163
            .:|.||
Zfish   235 DTDTDS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 18/67 (27%)
ORANGE 81..125 CDD:128787 10/43 (23%)
bhlhe40NP_997844.2 HLH 51..109 CDD:238036 16/63 (25%)
Hairy_orange 139..177 CDD:284859 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.