DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001013197.1 Gene:Hes6 / 316626 RGDID:1312047 Length:234 Species:Rattus norvegicus


Alignment Length:209 Identity:52/209 - (24%)
Similarity:89/209 - (42%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQE 74
            :.:.:||::|::||||:|:.|..|:.|:|   |.:...:::.||:||..|  .|.|...:..|:|
  Rat    35 FPQARKPLVEKKRRARINESLQELRLLLA---GTEVQAKLENAEVLELTV--RRVQGALRGRARE 94

  Fly    75 EQSLPLDS---FKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFI 136
            .:.|..::   |..||:..::||...:::...:...:...::.||    .......|..|..|.:
  Rat    95 REQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHL----LESMPLREGSSFRDLL 155

  Fly   137 QNSM-------DCSSMDK--APLSPASS--GYHSDCDS-------------PAPSPQPM------ 171
            .:|:       ..||...  :|.||.||  |...|..|             ||..|..:      
  Rat   156 GDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVPTSLGI 220

  Fly   172 ------QQPLWRPW 179
                  .|.:||||
  Rat   221 LTTARRAQSVWRPW 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 20/56 (36%)
ORANGE 81..125 CDD:128787 7/46 (15%)
Hes6NP_001013197.1 HLH 37..85 CDD:238036 19/52 (37%)
Hairy_orange 106..144 CDD:284859 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5369
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.750

Return to query results.
Submit another query.