Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013197.1 | Gene: | Hes6 / 316626 | RGDID: | 1312047 | Length: | 234 | Species: | Rattus norvegicus |
Alignment Length: | 209 | Identity: | 52/209 - (24%) |
---|---|---|---|
Similarity: | 89/209 - (42%) | Gaps: | 48/209 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQE 74
Fly 75 EQSLPLDS---FKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFI 136
Fly 137 QNSM-------DCSSMDK--APLSPASS--GYHSDCDS-------------PAPSPQPM------ 171
Fly 172 ------QQPLWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 20/56 (36%) |
ORANGE | 81..125 | CDD:128787 | 7/46 (15%) | ||
Hes6 | NP_001013197.1 | HLH | 37..85 | CDD:238036 | 19/52 (37%) |
Hairy_orange | 106..144 | CDD:284859 | 7/41 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334534 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 51 | 1.000 | Inparanoid score | I5369 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.750 |