Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571155.1 | Gene: | her3 / 30289 | ZFINID: | ZDB-GENE-980526-204 | Length: | 229 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 55/225 - (24%) |
---|---|---|---|
Similarity: | 94/225 - (41%) | Gaps: | 54/225 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 TTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-Q 65
Fly 66 KTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHL--GRVYKNLQQF-- 126
Fly 127 ------------------HEAQSAADFIQNSMDCSSMDKAPLSPASSGY-HSD---CDSPAPSPQ 169
Fly 170 P--------------------MQQPLWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 25/59 (42%) |
ORANGE | 81..125 | CDD:128787 | 9/45 (20%) | ||
her3 | NP_571155.1 | HLH | 17..77 | CDD:238036 | 26/60 (43%) |
ORANGE | 88..129 | CDD:128787 | 9/41 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573639 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |