DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and her3

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:225 Identity:55/225 - (24%)
Similarity:94/225 - (41%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-Q 65
            |.|.|..:||.||::|::||||:||||:.||:|: |....:.|  .:::||::||..|..:|. |
Zfish    10 TAKPQNVKKVSKPLMEKKRRARINKCLNQLKSLL-ESACSNNIRKRKLEKADILELTVKHLRHLQ 73

  Fly    66 KTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHL--GRVYKNLQQF-- 126
            .|.:.:::...|.   .:..||.:.:|.||..:.:: ....|....::|:|  |..:..:..|  
Zfish    74 NTKRGLSKACDSA---EYHAGYRSCLNTVSHYLRAS-DTDRDSRSIMLTNLTSGLNHNRVPDFST 134

  Fly   127 ------------------HEAQSAADFIQNSMDCSSMDKAPLSPASSGY-HSD---CDSPAPSPQ 169
                              |:.....|...:|...::..|..|.|..:.. .||   .|:...|.:
Zfish   135 VESDPALIFTLPSTLRRPHKVPIRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMSLDAALRSQE 199

  Fly   170 P--------------------MQQPLWRPW 179
            .                    .:|..||||
Zfish   200 SKKAETTHFRPKDLKVIECCIFKQNYWRPW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 25/59 (42%)
ORANGE 81..125 CDD:128787 9/45 (20%)
her3NP_571155.1 HLH 17..77 CDD:238036 26/60 (43%)
ORANGE 88..129 CDD:128787 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.