Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571154.2 | Gene: | her6 / 30288 | ZFINID: | ZDB-GENE-980526-144 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 237 | Identity: | 49/237 - (20%) |
---|---|---|---|
Similarity: | 94/237 - (39%) | Gaps: | 67/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMR-QQKTPKKV 71
Fly 72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ------------ 124
Fly 125 ------------QFHEAQSAADFIQ-NSMDCSSMDKAPLS-------------PASSG------- 156
Fly 157 -------------YHSDCDSPAP------SPQPMQQPLWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 22/59 (37%) |
ORANGE | 81..125 | CDD:128787 | 8/67 (12%) | ||
her6 | NP_571154.2 | HLH | 32..95 | CDD:238036 | 22/60 (37%) |
Hairy_orange | 110..148 | CDD:284859 | 8/37 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573735 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |