DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes1

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:165 Identity:42/165 - (25%)
Similarity:77/165 - (46%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71
            ::|..||::|::||||:|:.|..||||:.:....|..  .:::||::||..|..:|. |:.....
  Rat    34 HRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTA 98

  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFI 136
            |.......|..::.|:...:|||:|.:::..|::.::...::.||......:........|...:
  Rat    99 ALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPAL 163

  Fly   137 QNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPM 171
            |          ||..|..||......:|...|.|:
  Rat   164 Q----------APPPPPPSGPGGPQHAPFAPPPPL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/59 (37%)
ORANGE 81..125 CDD:128787 8/43 (19%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 3/9 (33%)
bHLH-O_HES1_4 33..95 CDD:381465 22/60 (37%)
Hairy_orange 110..148 CDD:400076 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281
WRPW motif 276..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.