DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus


Alignment Length:177 Identity:60/177 - (33%)
Similarity:90/177 - (50%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDD--GILRMDKAEMLESAVIFMRQQKTPKKVAQ 73
            :|..||:||::||||:|:.|..||.||..|.|.:  ...:::||::||..|.|:|:|  |..|..
  Rat    14 RKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLREQ--PASVCS 76

  Fly    74 EEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQN 138
            .|....|||:..||...:..::||:   |..|| |..:|.   .|:.::|:|             
  Rat    77 TEAPGSLDSYLEGYRACLARLARVL---PACSV-LEPAVS---ARLLEHLRQ------------- 121

  Fly   139 SMDCSSMDKAP--LSPASSGYHSDCDSPAPSPQPMQQP----LWRPW 179
                .::...|  |:|||:      .:||||| |:..|    |||||
  Rat   122 ----RTVSGGPPSLTPASA------SAPAPSP-PVPPPSSLGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 25/57 (44%)
ORANGE 81..125 CDD:128787 13/43 (30%)
Hes2NP_062109.1 HLH 12..69 CDD:238036 23/54 (43%)
ORANGE 84..128 CDD:128787 14/67 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 15/39 (38%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334599
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.