DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and lin-22

DIOPT Version :10

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:101 Identity:30/101 - (29%)
Similarity:54/101 - (53%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVK-KPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQQK------ 66
            :|:| ||::|::||||:||.|..||.::.:....:.|  .:.:||::||.||.:::|.:      
 Worm    21 KKIKNKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLRSAQPCS 85

  Fly    67 ---------TPKKVAQEEQSL-----PLDSFKNGYM 88
                     ||....:|.:::     |:.||.|..|
 Worm    86 LSPSTSSISTPPTPKEEIRNIKVPLNPIASFLNPMM 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 bHLH-O_ESM5_like 12..70 CDD:381486 24/75 (32%)
ORANGE 81..125 CDD:128787 4/8 (50%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 18/52 (35%)

Return to query results.
Submit another query.