DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hey2

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_569101.1 Gene:Hey2 / 155430 RGDID:621405 Length:339 Species:Rattus norvegicus


Alignment Length:159 Identity:40/159 - (25%)
Similarity:73/159 - (45%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTKTQIY-QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQ-QK 66
            ||.:||. :|.::.::|::||.|:|..|..|:.||.......|..:::|||:|:..|..::. |.
  Rat    41 TTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQA 105

  Fly    67 TPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGM--SVDLGKSVMTHLGRVYKNLQQFHEA 129
            |..|...:..:|..|....|:...:.||:|.::|..|:  |..|...:::||.            
  Rat   106 TGGKGYFDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLS------------ 158

  Fly   130 QSAADFIQNSMDCSSMDKAPLSPASSGYH 158
                       .|:|..:|.:..:|..:|
  Rat   159 -----------TCASQREAAVMTSSMSHH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 17/58 (29%)
ORANGE 81..125 CDD:128787 11/45 (24%)
Hey2NP_569101.1 HLH 49..105 CDD:238036 16/55 (29%)
ORANGE 120..165 CDD:128787 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.