DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:82/200 - (41%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLV-AELRGDDGILRMDKAEMLESAVIFMRQQK--------- 66
            :::||::|:.||.|:|..::.||.|: .|........:::||::||.||.:::..|         
Mouse   236 RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGEPGACARL 300

  Fly    67 -TPKKVAQEEQS--LPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHE 128
             .|..||...::  :|| .....:..|....|.....:.|.|..|.::|            ||..
Mouse   301 LLPADVAPTARAPLMPL-RLPTAFAAAAGPKSLHQDYSEGYSWCLQEAV------------QFLT 352

  Fly   129 AQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAP--SPQP--------------MQQP--- 174
            ..:|:|.....:.......||.:||.       :.|||  :|||              .:||   
Mouse   353 LHAASDTQMKLLYHFQRPPAPAAPAK-------EPPAPGAAPQPARSSAKAAAAAVSTSRQPACG 410

  Fly   175 LWRPW 179
            |||||
Mouse   411 LWRPW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 18/65 (28%)
ORANGE 81..125 CDD:128787 6/43 (14%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 17/55 (31%)
ORANGE 334..369 CDD:128787 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.