Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006538625.3 | Gene: | Hes5 / 15208 | MGIID: | 104876 | Length: | 415 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 82/200 - (41%) | Gaps: | 52/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KVKKPMLERQRRARMNKCLDNLKTLV-AELRGDDGILRMDKAEMLESAVIFMRQQK--------- 66
Fly 67 -TPKKVAQEEQS--LPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHE 128
Fly 129 AQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAP--SPQP--------------MQQP--- 174
Fly 175 LWRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 18/65 (28%) |
ORANGE | 81..125 | CDD:128787 | 6/43 (14%) | ||
Hes5 | XP_006538625.3 | bHLH-O_HES5 | 236..292 | CDD:381467 | 17/55 (31%) |
ORANGE | 334..369 | CDD:128787 | 8/46 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830907 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |