DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:175 Identity:58/175 - (33%)
Similarity:91/175 - (52%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDD--GILRMDKAEMLESAVIFMRQQKTPKKVAQ 73
            :|..||:||::||||:|:.|..||.||..|.|.:  ...:::||::||..|.|:::|  |..:..
Mouse    14 RKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQEQ--PATLYS 76

  Fly    74 EEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQN 138
            .....||:|:..||...:..::||:   |..|| |..:|.   .|:.::|:|    ::.:|    
Mouse    77 SAAPGPLNSYLEGYRACLARLARVL---PACSV-LEPAVS---ARLLEHLRQ----RTVSD---- 126

  Fly   139 SMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQP----LWRPW 179
              |..|:...| :||          ||||| |:..|    |||||
Mouse   127 --DSPSLTLPP-APA----------PAPSP-PVPPPGSSGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 24/57 (42%)
ORANGE 81..125 CDD:128787 12/43 (28%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 25/60 (42%)
ORANGE 85..123 CDD:128787 13/48 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 16/50 (32%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5264
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.