DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and her9

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:266 Identity:53/266 - (19%)
Similarity:97/266 - (36%) Gaps:104/266 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71
            ::|..||::|::||||:|:.|..||||:.:....|..  .:::||::||..|..:|. |:.....
Zfish    34 HRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMSA 98

  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNL-----------QQ 125
            |....:..|..::.|:...:|||:|.:::..|::.::...::.||......:           ||
Zfish    99 ALSADTNVLSKYRAGFNECMNEVTRFLSTCEGVNTEVRSRLLNHLSGCMGQMMAMNYPQPAPAQQ 163

  Fly   126 FHEAQSAADFIQNSMDCSSMDKAPLSPASSGYH---SDCDSP-------------------APSP 168
            .|.||.....:.:::        |::.||.|..   |:..||                   .|:|
Zfish   164 AHLAQPLHVQLPSTL--------PINGASMGSKLSPSEAVSPKVFGGFQLVPATDGQFAFLIPNP 220

  Fly   169 ------------------------------------QPMQ------------------------Q 173
                                                .|:|                        :
Zfish   221 AFASATTPVIPLYANASVPVTVNASPVQASSAPTVASPVQGMTSFSGVPQAVSPVGVSAGAESNE 285

  Fly   174 PLWRPW 179
            |:||||
Zfish   286 PVWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/59 (37%)
ORANGE 81..125 CDD:128787 8/54 (15%)
her9NP_571948.1 HLH 32..93 CDD:238036 21/58 (36%)
Hairy_orange 110..147 CDD:284859 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.