DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hry

DIOPT Version :10

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_316733.4 Gene:hry / 1277284 VectorBaseID:AGAMI1_005577 Length:374 Species:Anopheles gambiae


Alignment Length:180 Identity:43/180 - (23%)
Similarity:75/180 - (41%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKVA 72
            ::..||::|::||||:|.||:.||||:.:....|..  .:::||::||..|..:.. |:....::
Mosquito    34 RRSNKPIMEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENLQRQQTAMS 98

  Fly    73 QEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNL-----------QQF 126
            |......::.||.|:.....||.|.    |.:...:.:.::.||......:           ||.
Mosquito    99 QATDPSVMNKFKAGFNECAQEVGRF----PELEPHVKRRLLQHLNNCINGVNKSDLPKRHHHQQQ 159

  Fly   127 HEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAP-----SPQPM 171
            |:.|..            :...|.||...|:      |.|     .|.|:
Mosquito   160 HQQQHI------------LPSPPSSPEQHGH------PHPYGLAGHPGPL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 bHLH-O_ESM5_like 12..70 CDD:381486 21/60 (35%)
ORANGE 81..125 CDD:128787 9/54 (17%)
hryXP_316733.4 None

Return to query results.
Submit another query.