DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:102 Identity:29/102 - (28%)
Similarity:54/102 - (52%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLE------SAVIFMRQQKTPKK 70
            |:...::|::||.|:|:|:..||.|:.|......:..::||.:||      .|:..:.:|:..|.
  Rat    46 KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKI 110

  Fly    71 VAQE--EQSL------PLDSFKNGYMNAVNEVSRVMA 99
            :|.:  |:||      .||:|.:|:.....||.:.:|
  Rat   111 IALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 17/60 (28%)
ORANGE 81..125 CDD:128787 6/19 (32%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 22/75 (29%)
ORANGE 129..175 CDD:128787 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.