DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hes7.2

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:221 Identity:50/221 - (22%)
Similarity:95/221 - (42%) Gaps:55/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGIL--RMDKAEMLESAVIFMRQQKTPKKVAQ 73
            :::.||::|::||.|:|:.|::|:||:.|...|:.:.  :.:||::|:..|.|::....|  |..
 Frog    25 KRLMKPVIEKRRRDRINQSLEHLRTLLLEATHDETLKNPKAEKADILKKTVHFLKMCHNP--VPS 87

  Fly    74 EEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADF--- 135
            :.:.| |..||.|:...:|:.:..:.|...:.....:.|:..|.:..:...|.|...||.|.   
 Frog    88 DGKKL-LSGFKGGFREGLNQATSFLNSADSICQKKKEYVVQRLCQHMEQQTQKHCHDSAQDVSSR 151

  Fly   136 -----------IQNSMDCSSMDKAPLSPASSGYHSDCDSPAPS--------------PQ------ 169
                       :.:.:..:.::::|.:..|...||...||:.|              ||      
 Frog   152 VNQRQILPSPPLISRVTGNGLEQSPETQTSRPPHSHHPSPSSSFRTPCMGQEQQQTPPQTFQANT 216

  Fly   170 ---PMQQPL-------------WRPW 179
               |.|:.|             ||||
 Frog   217 NKKPTQRTLFPPTSSSVNSALVWRPW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 18/57 (32%)
ORANGE 81..125 CDD:128787 7/43 (16%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 18/54 (33%)
ORANGE 94..138 CDD:128787 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.