Sequence 1: | NP_524513.1 | Gene: | E(spl)m8-HLH / 43161 | FlyBaseID: | FBgn0000591 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002942675.1 | Gene: | hes7.2 / 100496131 | XenbaseID: | XB-GENE-486482 | Length: | 243 | Species: | Xenopus tropicalis |
Alignment Length: | 221 | Identity: | 50/221 - (22%) |
---|---|---|---|
Similarity: | 95/221 - (42%) | Gaps: | 55/221 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGIL--RMDKAEMLESAVIFMRQQKTPKKVAQ 73
Fly 74 EEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADF--- 135
Fly 136 -----------IQNSMDCSSMDKAPLSPASSGYHSDCDSPAPS--------------PQ------ 169
Fly 170 ---PMQQPL-------------WRPW 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m8-HLH | NP_524513.1 | HLH | 10..67 | CDD:238036 | 18/57 (32%) |
ORANGE | 81..125 | CDD:128787 | 7/43 (16%) | ||
hes7.2 | XP_002942675.1 | HLH | 22..80 | CDD:238036 | 18/54 (33%) |
ORANGE | 94..138 | CDD:128787 | 7/43 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |