DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and hes5.3

DIOPT Version :9

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:186 Identity:48/186 - (25%)
Similarity:77/186 - (41%) Gaps:55/186 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAE----LRGDDGILRMDKAEMLESAVIFMRQ 64
            |||.:  .|::|||:|:.||.|:|..::.|:.|:.:    |:.|.   :.:||::||.||.|::|
 Frog    20 TTKQK--NKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPDS---KPEKADILELAVKFLKQ 79

  Fly    65 Q-----KTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ 124
            |     |..:|..|:        |..||.|.::|....::                         
 Frog    80 QICSQSKNNRKDYQD--------FSQGYSNCLHETFAFLS------------------------- 111

  Fly   125 QFHEAQSAADF-IQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179
             ||..:..... :.|...|  :|..|...:.|..|    ...|.|....:.|||||
 Frog   112 -FHRTEEEMQLKLMNHFQC--LDSQPRGISVSSSH----QKGPGPVASTKILWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/65 (34%)
ORANGE 81..125 CDD:128787 5/43 (12%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 22/60 (37%)
Hairy_orange 93..135 CDD:383064 11/77 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.