Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003661.1 | Gene: | BHLHE40 / 8553 | HGNCID: | 1046 | Length: | 412 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 86/207 - (41%) | Gaps: | 45/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKE 70
Fly 71 ---------------------SKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMT 114
Fly 115 HLGMRLNQLEQ------PMEQPQAV----NTPLSIVCGSSSSSS----------TYSSASSCSSI 159
Fly 160 SPVSSGYASDNE 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 25/80 (31%) |
ORANGE | 81..125 | CDD:128787 | 12/43 (28%) | ||
BHLHE40 | NP_003661.1 | Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer | 1..139 | 28/93 (30%) | |
bHLH-O_DEC1 | 40..129 | CDD:381592 | 26/83 (31%) | ||
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 | 75..79 | 3/3 (100%) | |||
ORANGE | 140..184 | CDD:128787 | 13/44 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..303 | 15/69 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140939 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |