DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:231 Identity:63/231 - (27%)
Similarity:93/231 - (40%) Gaps:52/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD-----AKFEKADILEV 60
            |.|: |.::.....|::|||:|::||.|||:.|:||:.|:.|   :|.|     .|.|||:|||.
Mouse     1 MVTR-ERAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLE---RTRDQNLRNPKLEKAEILEF 61

  Fly    61 TVQHLR-KLKESKKHVPANPEQSFRA---GYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLN 121
            .|.:|| :.:.....||.:|.|...|   .|:....|....||:... |.:  ....:.|...|:
Mouse    62 AVGYLRERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAH-DAS--PAARSQLFSALH 123

  Fly   122 QLEQPM-EQPQAVN----------TPLSIVCGSS-----------SSSSTYSSASSCSS------ 158
            ...:|. .:|:||:          .|.|.:.|.:           .|.....|.|.|||      
Mouse   124 GYRRPKPPRPEAVDPGLPAPRPPLDPASPILGPALHQRPPVHQGPPSPRLAWSPSHCSSRAGDSG 188

  Fly   159 --------ISPVSSGYASDNESLLQISSPGQVWRPW 186
                    :.|....|..|.........|...||||
Mouse   189 APAPLTGLLPPPPPPYRQDGAPKAPSLPPPAFWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 27/65 (42%)
ORANGE 81..125 CDD:128787 9/46 (20%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 27/61 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 21/101 (21%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.