DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Bhlhe40

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_445780.2 Gene:Bhlhe40 / 79431 RGDID:68439 Length:411 Species:Rattus norvegicus


Alignment Length:207 Identity:55/207 - (26%)
Similarity:90/207 - (43%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKE 70
            :..:||   |:...|:|:|||.|||:|:.:||||:.|.:..|.....|||.:||:|::|::.|..
  Rat    48 DSKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTN 109

  Fly    71 ---------------------SKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMT 114
                                 |.:::.|..|. |.:|:...|.||.:.||..........:.|:|
  Rat   110 LIDQQQQKIMALQSGLQAGDLSGRNIEAGQEM-FCSGFQTCAREVLQYLAKHENTRDLKSSQLVT 173

  Fly   115 HLGMRLNQLEQ------PMEQ-PQAVN---TPLSIVCGSSSSSS--------TY--SSASSCSSI 159
            ||...:::|.|      |::. |:.|:   .|..:..||.....        |:  |......|.
  Rat   174 HLHRVVSELLQGSASRKPLDSAPKPVDFKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSD 238

  Fly   160 SPVSSGYASDNE 171
            :...|||..:.|
  Rat   239 TDTDSGYGGELE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/80 (31%)
ORANGE 81..125 CDD:128787 12/43 (28%)
Bhlhe40NP_445780.2 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250 1..139 28/93 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
bHLH-O_DEC1 40..129 CDD:381592 26/83 (31%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 3/3 (100%)
ORANGE 140..184 CDD:128787 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..293 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.