DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her4.3

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001154880.1 Gene:her4.3 / 792198 ZFINID:ZDB-GENE-081030-7 Length:152 Species:Danio rerio


Alignment Length:183 Identity:53/183 - (28%)
Similarity:83/183 - (45%) Gaps:48/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KTYQYRKVMKPLLERKRRARINKCLDELKDLMA-ECVAQTGDAKFEKADILEVTVQHLRKLKESK 72
            :|....|:.||::|:.||.|||..:::||.|:| |.:.|..|::.|||||||:|:..||:   |:
Zfish    13 ETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFIKQQPDSRQEKADILEMTLDFLRR---SQ 74

  Fly    73 KHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQL----EQPMEQPQAV 133
            |...|...:|      |...|....|:..|         :.|....||.:|    :.|.:|...|
Zfish    75 KSSAAGDGRS------RCVQEAVSFLSQCP---------VQTQSHTRLMKLFLHMQTPADQHTRV 124

  Fly   134 NTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
            :.|        .::.|::: ||....:||.|                .:||||
Zfish   125 DNP--------QTTETHAN-SSAKQHTPVRS----------------HIWRPW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 27/60 (45%)
ORANGE 81..125 CDD:128787 9/47 (19%)
her4.3NP_001154880.1 HLH 19..75 CDD:238036 27/58 (47%)
ORANGE 77..123 CDD:128787 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.